Publications

This section includes a list of the latest IPNA scientific articles published in journals included in the Science Citation Index (SCI).

In DIGITAL.CSIC, institutional repository of the CSIC, you can find the complete list of scientific articles since 1962, as well as other collections of interest such as congresses, theses, books, informative material, etc. of the centre. The aim of DIGITAL.CSIC is to organize, preserve and disseminate in open access the results of our research.

In the institutional repository of the CSIC, you can find the complete list of scientific articles, as well as other collections of interest such as congresses, theses, books, informative material, etc.

Go to Digital - CSIC

 

Analysis of the IPNA 2014-2019 Scientific Production: bibliometric analysis from data collected in Scopus and Web of Science.

 

Image
Digital CSIC

Efficient Oral Priming of Tenebrio molitor Larvae Using Heat-Inactivated Microorganisms

Microbial resistance is a global health problem that will increase over time. Advances in insect antimicrobial peptides (AMPs) offer a powerful new approach to combat antimicrobial resistance. Invertebrates represent a rich group of animals for the discovery of new antimicrobial agents due to their high diversity and the presence of adaptive immunity or “immune priming”. Here, we report a priming approach for Tenebrio molitor that simulates natural infection via the oral route. This oral administration has the advantage of minimizing the stress caused by conventional priming techniques and could be a viable method for mealworm immunity studies. When using inactivated microorganisms for oral priming, our results showed an increased survival of T. molitor larvae after exposure to various pathogens. This finding was consistent with the induction of antimicrobial activity in the hemolymph of primed larvae. Interestingly, the hemolymph of larvae orally primed with Escherichia coli showed constitutive activity against Staphylococcus aureus and heterologous activity for other Gram-negative bacteria, such as Salmonella enterica. The priming of T. molitor is generally performed via injection of the microorganism. To our knowledge, this is the first report describing the oral administration of heat-inactivated microorganisms for priming mealworms. This technique has the advantage of reducing the stress that occurs with the conventional methods for priming vertebrates.

González-Acosta, Sergio; Baca-González, Victoria; Asensio-Calavia, Patricia; Otazo-Pérez, Andrea; López, Manuel R.; Morales-delaNuez, Antonio; Pérez de Lastra, José Manuel.

Vaccines, 10(8), 1296 : 1-11 (2022)
DOIDigital.CSIC

Influence of Meteorological Temperature and Pressure on the Severity of Heart Failure Decompensations

Objective: To investigate the relationship between ambient temperature and atmospheric pressure (AP) and the severity of heart failure (HF) decompensations.

Methods: We analysed patients coming from the Epidemioloy Acute Heart Failure Emergency (EAHFE) Registry, a multicentre prospective cohort study enrolling patients diagnosed with decompensated HF in 26 emergency departments (EDs) of 16 Spanish cities. We recorded patient and demographic data and maximum temperature (Tmax) and AP (APmax) the day before ED consultation. Associations between temperature and AP and severity endpoints were explored by logistic regression. We used restricted cubic splines to model continuous non-linear associations of temperature and AP with each endpoint.

Results: We analysed 16,545 patients. Daily Tmax and APmax (anomaly) of the day before patient ED arrival ranged from 0.8 to 41.6° and from − 61.7 to 69.9 hPa, respectively. A total of 12,352 patients (75.2%) were hospitalised, with in-hospital mortality in 1171 (7.1%). The probability of hospitalisation by HF decompensation showed a U-shaped curve versus Tmax and an increasing trend versus APmax. Regarding temperature, hospitalisation significantly increased from 20 °C (reference) upwards (25 °C: OR = 1.12, 95% CI = 1.04–1.21; 40 °C: 1.65, 1.13–2.40) and below 5.4 °C (5 °C: 1.21, 1.01–1.46). Concerning the mean AP of the city (anomaly = 0 hPa), hospitalisation increased when APmax (anomaly) was above + 7.0 hPa (atmospheric anticyclone; + 10 hPa: 1.14, 1.05–1.24; + 30 hPa: 2.02. 1.35–3.03). The lowest probability of mortality also corresponded to cold-mild temperatures and low AP, with a significant increased risk only found for Tmax above 24.3 °C (25 °C: 1.13, 1.01–1.27; 40 °C: 2.05, 1.15–3.64) and APmax (anomaly) above + 3.4 hPa (+ 10 hPa: 1.21, 1.07–1.36; + 30 hPa: 1.73, 1.06–2.81). Sensitivity analysis confirmed the main analysis results.

Conclusion: Temperature and AP are independently associated with the severity of HF decompensations, with possible different effects on the need for hospitalisation and in-hospital mortality.

Miró, Òscar; Benito-Lozano, Miguel; Lopez-Ayala, Pedro; Rodríguez, Sergio; Llorens, Pere; Yufera-Sanchez, Ana; Jacob, Javier; Traveria, Lissete; Strebel, Ivo; Gil, Víctor; Tost, Josep; López-Hernández, Maria de los Angeles; Alquézar-Arbé, Aitor; Espinosa, Begoña; Mueller, Christian; Burillo-Putze, Guillermo.

Journal of general internal medicine, 38: 600–609 (2023)
DOIDigital.CSIC

Modulation of Popocatépetl’s activity by regional and worldwide earthquakes

Volcanoes switching from quiescence to eruption shortly after catastrophic earthquakes have raised interest for volcanic triggering and the influence of earthquakes on volcanic activity. Its influence on already active systems and especially at open-vent volcanoes is more difficult to apprehend. A number of recent observations suggest an influence of tectonic earthquakes on Popocatépetl’s activity, the importance of which remains unknown. To further investigate this, we introduce an index, based on the near-field concept, identifying the earthquakes with the highest potential to promote volcanic activity (hereafter termed “significant earthquakes”). The time series of significant earthquakes is compared with the intensity of the volcanic activity, as characterized by the number and energy of volcano-tectonic earthquakes, the number of dome extrusions, the intensity of thermal and degassing fluxes, and ash production. Three main periods with contrasting activity stand out showing that Popocatépetl presents intense activity when significant tectonic earthquakes are frequent. Enhanced extrusion apparently follows significant earthquakes quickly with pulses of dome extrusion that peak after 1.3 ± 0.3 years. Conversely, extrusive activity vanishes when significant seismicity disappears, as during the period 2003–2011, which coincides with a 12-year-long significant seismicity gap. Hence, we propose that the 1994–2022 open-vent activity at Popocatépetl is in part modulated by the repetitive occurrence of significant earthquakes that periodically promote volcanic activity.

Boulesteix, Thomas; Legrand, Denis;Taquet, Noémie; Coppola, Diego; Laiolo, Marco; Valade, Sébastien; Massimetti, Francesco; Caballero-Jiménez, Gema; Campion, Robin.

Bulletin of Volcanology, 84 (2022)
DOIDigital.CSIC

Solid-Supported Tetrahydropyran-Based Hybrid Dipeptide Catalysts for Michael Addition of Aldehydes to Nitrostyrenes

The heterogenization of homogeneous catalysts onto a solid support is a step towards a more sustainable chemistry. The recovery and reuse of catalysts is extremely important from a practical, economic and environmental point of view. In this regards, we report a series of polymer-supported tetrahydropyran-based hybrid dipeptides that serve as active catalysts for the enantioselective Michael addition of aldehydes to β-nitrostyrenes. These supported catalysts have been designed considering the optimal anchor position and orientation between the catalyst and the solid support. Additionally, the influence of the linker length on the catalytic efficiency was studied. The catalysts allowed the transformation of a variety of substrates in 76–98% yield and with 94–97% enantiomeric excess. Detailed deactivation studies have provided important information, which allows to increase the useful life of these immobilized catalysts.

García-Monzón, Irma; Borges-González, Jorge; Martín, Tomás

Advanced Synthesis & Catalysis 2022, 364
DOIDigital.CSIC

Shortest Enantioselective Total Syntheses of (+)-Isolaurepinnacin and (+)-Neoisoprelaurefucin

The shortest enantioselective total syntheses of (+)-isolaurepinnacin and (+)-neoisoprelaurefucin have been accomplished. These syntheses were based on a common parallel synthetic strategy using Prins–Peterson cyclization in their core construction. In only one step, a seven-membered ring oxacycle with the correct cis-stereochemistry ring closure and the Δ4 position of the endocyclic double bond in (+)-isolaurepinnacin was obtained. This unsaturation was also necessary to accede to the bromodioxabicycle on (+)-neoisoprelaurefucin.

Sinka, Victoria; Cruz, Daniel A.; Martín, Víctor S.; Padrón, Juan I.

Organic Letters 2022, 24, 29, 5271–5275
DOIDigital.CSIC

Exormotheca martins-loussaoae (Exormothecaceae, Hepaticae), a new species from Cape Verde

Former phylogenetic evidence for the genus Exormotheca revealed the existence of a distinct and monophyletic clade restricted to the oceanic archipelago of Cape Verde. During the fieldwork carried out in Cape Verde between 2016 and 2019, we found distinctive populations of Exormotheca. In this study, we aim to investigate the Exormotheca pustulosa complex and its relationship to other Exormotheca species that coexist in the same geographical areas, using morphological characteristics, and to present a formal description of a new Exormotheca species from Cape Verde Archipelago. A total of 60 specimens belonging to Exormotheca genus were examined. The specimens included samples, with broad taxonomic coverage of the E. pustulosa species, as well as from two phylogenetically close taxa E. holstii, and E. welwitschii. The characters studied were selected based on previous works that describe and distinguish species within the genus Exormotheca, and from our own observations. A new species, Exormotheca martins-loussaoae from Cape Verde is described. The new species can be recognized by the dark green color of the thallus and the almost entire dark purple scales, and the thallus surface having 6 − 9 regular rows with large conical air chambers, occupied by a thin assimilation tissue.

Martins, Anabela; García, César Augusto; Patiño, Jairo; Sim-Sim, Manuela

Plant Biosystems: 1-8 (2022)
DOIDigital.CSIC

Chemistry of Hydrogen Peroxide Formation and Elimination in Mammalian Cells, and Its Role in Various Pathologies

Hydrogen peroxide (H2O2) is a compound involved in some mammalian reactions and processes. It modulates and signals the redox metabolism of cells by acting as a messenger together with hydrogen sulfide (H2S) and the nitric oxide radical (•NO), activating specific oxidations that determine the metabolic response. The reaction triggered determines cell survival or apoptosis, depending on which downstream metabolic pathways are activated. There are several ways to produce H2O2 in cells, and cellular systems tightly control its concentration. At the cellular level, the accumulation of hydrogen peroxide can trigger inflammation and even apoptosis, and when its concentration in the blood reaches toxic levels, it can lead to bioenergetic failure. This review summarizes existing research from a chemical perspective on the role of H2O2 in various enzymatic pathways and how this biochemistry leads to physiological or pathological responses.

Curieses Andrés, Celia María; Pérez de Lastra, José Manuel; Andrés Juan, Celia; Plou Gasca, Francisco José; Pérez-Lebeña, Eduardo.

Stresses, 2 (3) : 256-274 (2022)
DOIDigital.CSIC

Toward global integration of biodiversity big data: a harmonized metabarcode data generation module for terrestrial arthropods

Metazoan metabarcoding is emerging as an essential strategy for inventorying biodiversity,with diverse projects currently generating massive quantities of community-level data. The potential for integrating across such data sets offers new opportunities to better understand biodiversity and how it might respond to global change. However, large-scale synthesesmay be compromised if metabarcoding workflows differ from each other. There are ongoing efforts to improve standardization for the reporting of inventory data. However, harmonization at the stage of generating metabarcode data has yet to be addressed. A modular framework for harmonized data generation offers a pathway to navigate the complex structure of terrestrial metazoan biodiversity. Here, through our collective expertise as practitioners,method developers, and researchers leading metabarcoding initiatives to inventory terrestrial biodiversity, we seek to initiate a harmonized framework for metabarcode data generation, with a terrestrial arthropod module. We develop an initial set of submodules covering the 5 main steps of metabarcode data generation: (i) sample acquisition; (ii) sample processing; (iii) DNA extraction; (iv) polymerase chain reaction amplification, library preparation, and sequencing; and (v) DNA sequence and metadata deposition, providing a backbone for a terrestrial arthropod module. To achieve this, we (i) identified key points for harmonization, (ii) reviewed the current state of the art, and (iii) distilled existing knowledge within submodules, thus promoting best practice by providing guidelines and recommendations to reduce the universe of methodological options.We advocate the adoption and further development of the terrestrial arthropodmodule.We further encourage the development of modules for other biodiversity fractions as an essential step toward large-scale biodiversity synthesis through harmonization.

Arribas, Paula; Andújar, Carmelo; Bohmann, Kristine; deWaard, Jeremy R.; Economo, Evan P.; Elbrecht, Vasco; Geisen, Stefan; Goberna, Marta; Krehenwinkel, Henrik; Novotny, Vojtech; Zinger, Lucie; Creedy, Thomas J.; Meramveliotakis, Emmanouil; Noguerales, Víctor; Overcast, Isaac; Morlon, Hélène; Papadopoulou, Anna; Vogler, Alfried P.; Emerson, Brent C.

Giga Science, 11: 1-12 (2022)
DOIDigital.CSIC

Antimicrobial Activity of Cathelicidin-Derived Peptide from the Iberian Mole Talpa occidentalis

The immune systems of all vertebrates contain cathelicidins, a family of antimicrobial peptides. Cathelicidins are a type of innate immune effector that have a number of biological functions, including a well-known direct antibacterial action and immunomodulatory function. In search of new templates for antimicrobial peptide discovery, we have identified and characterized the cathelicidin of the small mammal Talpa occidentalis. We describe the heterogeneity of cathelicidin in the order Eulipotyphla in relation to the Iberian mole and predict its antibacterial activity using bioinformatics tools. In an effort to correlate these findings, we derived the putative active peptide and performed in vitro hemolysis and antimicrobial activity assays, confirming that Iberian mole cathelicidins are antimicrobial. Our results showed that the Iberian mole putative peptide, named To-KL37 (KLFGKVGNLLQKGWQKIKNIGRRIKDFFRNIRPMQEA) has antibacterial and antifungal activity. Understanding the antimicrobial defense of insectivores may help scientists prevent the spread of pathogens to humans. We hope that this study can also provide new, effective antibacterial peptides for future drug development.

Otazo-Pérez, Andrea; Asensio-Calavia, Patricia; González-Acosta, Sergio; Baca-González, Victoria; López, Manuel R; Morales-De la Nuez, Antonio; Pérez de la Lastra, José Manuel.

Vaccines 10(7): 1105(2022)
DOIDigital.CSIC

Cellular landscaping of cisplatin resistance in cervical cancer

Cervical cancer (CC) caused by human papillomavirus (HPV) is one of the largest causes of malignancies in women worldwide. Cisplatin is one of the widely used drugs for the treatment of CC is rendered ineffective owing to drug resistance. This review highlights the cause of resistance and the mechanism of cisplatin resistance cells in CC to develop therapeutic ventures and strategies that could be utilized to overcome the aforementioned issue. These strategies would include the application of nanocarries, miRNA, CRIPSR/Cas system, and chemotherapeutics in synergy with cisplatin to not only overcome the issues of drug resistance but also enhance its anti-cancer efficiency. Moreover, we have also discussed the signaling network of cisplatin resistance cells in CC that would provide insights to develop therapeutic target sites and inhibitors. Furthermore, we have discussed the role of CC metabolism on cisplatin resistance cells and the physical and biological factors affecting the tumor microenvironments.

Bhattacharjeea, Rahul; Deya, Tanima; Kumar, Lamha; Kar, Sulagna; Sarkar, Ritayan; Ghorai, Mimosa; Malik, Sumira; Kumar Jha, Niraj; Vellingiri, Balachandar; Kumar Kesari, Kavindra; Pérez de Lastra, José Manuel; Dey, Abhijit.

Biomedicine and Pharmacotherapy, 153, 113345: 1-18 (2022)
DOIDigital.CSIC